PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB03G11760.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family M-type_MADS
Protein Properties Length: 175aa    MW: 19988.4 Da    PI: 9.9525
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB03G11760.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF95.62.2e-30959151
                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  krien + rqvtfskRrng+lKKA+ELSvLCdaeva+i+fs++gklye++s
  OB03G11760.1  9 KRIENPTSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFAS 59
                  79***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.8E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.735161IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-31323IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.75E-29362IPR002100Transcription factor, MADS-box
CDDcd002651.59E-38363No hitNo description
PfamPF003191.4E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-313859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MVRGKTQMKR IENPTSRQVT FSKRRNGLLK KAFELSVLCD AEVALIVFSP RGKLYEFASA  60
SCRLNCHGFG KQINCETGKI KVVKIYATHY CHSGRQYDEY TVGSRPISRE PPNLSKALQL  120
KRHSLLPQLH KWIKENYEIL HLDLSCCLEG TLSRLALYPK YVMHLCGSQK AIICT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A3e-17361260Myocyte-specific enhancer factor 2A
3mu6_B3e-17361260Myocyte-specific enhancer factor 2A
3mu6_C3e-17361260Myocyte-specific enhancer factor 2A
3mu6_D3e-17361260Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8291382e-92CT829138.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN046P14, full insert sequence.
GenBankCU4063792e-92CU406379.1 Oryza rufipogon (W1943) cDNA clone: ORW1943S104H08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLJ3LJF01e-129J3LJF0_ORYBR; Uncharacterized protein
STRINGOB03G11760.11e-128(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G11880.11e-35AGAMOUS-like 14